PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr040212.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family G2-like
Protein Properties Length: 397aa    MW: 44184.6 Da    PI: 8.5613
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr040212.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.65.9e-33260315156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Pbr040212.1 260 KQRRCWSPELHRRFVNALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 315
                  79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.318257317IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.6E-30257318IPR009057Homeodomain-like
SuperFamilySSF466892.19E-18257318IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-27260315IPR006447Myb domain, plants
PfamPF002496.1E-8262313IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MGSVPPELSL DFKPTFVPKT ISDFLKEVSM IGNVSEKLSK LDDFVKRLED EMRKIDAFKR  60
ELPLCMFLLN DAIRALKEDA MQCAAPKVQP VLEEFIPMKK DCDKNKGGSG NNNKKEKDSR  120
DKKNWMSSVQ LWNTDNFHQH PSGDSPYDRK RVSEIDSKRN EAENGVANED PFQTCRNRTG  180
GRAFMPFKGY PAFSVTPLRL EEKEELPVHG LSLLTPGIKN PKEESTSSGS RSTCGRSVSF  240
STANTQSNMR TPPQQPTSRK QRRCWSPELH RRFVNALQQL GGSQVATPKQ IRELMQVDGL  300
TNDEVKSHLQ KYRLHTRRVP GAAAAGSEKQ SVGLGALWMS QDQYVDSSKA GSSQSGSPQG  360
PLQLTGTGGD DEDDEDAKSE SYSWKGYIHK PGKDDV*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009345969.10.0PREDICTED: uncharacterized protein LOC103937746
RefseqXP_009345970.10.0PREDICTED: uncharacterized protein LOC103937747
TrEMBLM5VM720.0M5VM72_PRUPE; Uncharacterized protein
STRINGVIT_03s0063g01060.t011e-177(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-56G2-like family protein